Shop.polishfoodies.com is a subdomain of polishfoodies.com, which was created on 2019-11-25,making it 4 years ago.
Description:New Products! Don’t miss out on some very special items at extraordinary prices. For a limited time! Pick up a bargain → Why Polish Foodies Shop? We believe in connecting all Poles around the World....
Discover shop.polishfoodies.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 243.496 KB |
Page Load Time: 0.522326 Seconds |
Website IP Address: 104.21.3.167 |
My Swiss Kitchen - Feeding Foodies in the Alps myswisskitchen.swisshikingvacations.com |
Chicagosocietypna.org - Chicago Society of the Polish National Alliance chicagosocietypna.org.wenotify.net |
Music | The Polish Ambassador thepolishambassador.bandcamp.com |
Polish & Slavic Federal Credit Union ibank.psfcu.com |
Polish & Slavic Federal Credit Union psfcu.locatorsearch.com |
Home - Polish Festival festiwal.polskaparafiaphoenix.com |
CIA Foodies - Experience the World of Food with Culinary Institute of America enthusiasts.ciachef.edu |
OPI Nail Polish Nail Care & Nail Art OPI® colorchat.opi.com |
LOT Polish Airlines | Book Airline Tickets | LOT.com m.lot.com |
Simichrome Metal Polish - Great for Polishing Chrome, Brass, Gold, Silver, Motorcyclces, Antiques, simichrome.premiumstore.com |
Polish Slavic Center - HOME - Polish Slavic Center New York en.polishslaviccenter.us |
Business events; webinars workshops etc. about the Polish events.bizinpoland.com |
Digital Platform of Polish Geological geojournals.pgi.gov.pl |
Polish Home Association Gallery – A visual history of the Polish Home Association, other gallery.polishhome.org |
Polish Foodies: Home https://shop.polishfoodies.com/ |
Women Archives https://shop.polishfoodies.com/category/women/ |
Customer Help https://shop.polishfoodies.com/customer-help/ |
Polish Themed Accessories Archives https://shop.polishfoodies.com/category/accessories/ |
Contact us https://shop.polishfoodies.com/contact-us/ |
Terms and conditions https://shop.polishfoodies.com/terms-and-conditions/ |
Headband Folk https://shop.polishfoodies.com/product/headband-folk/ |
Scrunchie Folk https://shop.polishfoodies.com/product/scrunchie-folk/ |
Poland Clothes Archives https://shop.polishfoodies.com/category/poland-clothes/ |
Polish Cookbooks Archives https://shop.polishfoodies.com/category/polish-cookbooks/ |
Date: Sun, 12 May 2024 19:39:07 GMT |
Content-Type: text/html; charset=utf-8 |
Transfer-Encoding: chunked |
Connection: keep-alive |
CF-Ray: 882cdf7d7a3f2f35-LAX |
CF-Cache-Status: REVALIDATED |
Cache-Control: max-age=31536000 |
Expires: Sun, 12 May 2024 19:39:07 GMT |
Last-Modified: Tue, 23 Apr 2024 10:35:55 GMT |
Strict-Transport-Security: max-age=15552000; preload |
Vary: Accept-Encoding |
cache-provider: CLOUDWAYS-CACHE-DE |
cf-apo-via: origin,host |
x-cache: MISS |
X-Content-Type-Options: nosniff |
Report-To: "endpoints":["url":"https:\\/\\/a.nel.cloudflare.com\\/report\\/v4?s=m04LaiRZp3UZV9YEnbFJ5kc4DoxPW4tmKdiq1Govy74q9DGzIM4LaWo3KyZ17vcC5mPwcSFXpMJro%2BD4eBpw%2BHTmWS9PktSKB7TlggYBfLOUAILpyG4doLeyBHwaf8jQZ6kASLsVaullEbDlx3SreVe5Xfnj"],"group":"cf-nel","max_age":604800 |
NEL: "success_fraction":0,"report_to":"cf-nel","max_age":604800 |
Server: cloudflare |
alt-svc: h3=":443"; ma=86400 |
charset="utf-8"/ |
content="height=device-height, width=device-width, initial-scale=1" name="viewport"/ |
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots" |
content="en_US" property="og:locale" |
content="website" property="og:type"/ |
content="Home - Polish Foodies" property="og:title"/ |
content="New Products! Don’t miss out on some very special items at extraordinary prices. For a limited time! Pick up a bargain → Why Polish Foodies Shop? We believe in connecting all Poles around the World. With a clever offering, superb support and a secure checkout you’re in good hands. Smart ideas With dozens of intelligent […]" property="og:description"/ |
content="https://shop.polishfoodies.com/" property="og:url"/ |
content="Polish Foodies" property="og:site_name"/ |
content="https://www.facebook.com/groups/polishfoodies/" property="article:publisher"/ |
content="2022-06-16T07:42:51+00:00" property="article:modified_time"/ |
content="https://shop.polishfoodies.com/wp-content/uploads/2020/07/hero_girl_optimized.jpg" property="og:image"/ |
content="summary_large_image" name="twitter:card"/ |
content="WordPress 6.5.2" name="generator"/ |
content="WooCommerce 8.8.2" name="generator"/ |
content="Site Kit by Google 1.118.0" name="generator"/ |
content="EZvIG0ULCsq_bLUQdZQOqfGkIAVyahpsrah8Rby5Uww" name="google-site-verification"/ |
content="mrSc3KTmSlhxqRBRDvWhcEwC8vARD0t1a3b7IBgTqpo" name="google-site-verification"/ |
content="Elementor 3.21.1; features: e_optimized_assets_loading, additional_custom_breakpoints; settings: css_print_method-external, google_font-enabled, font_display-auto" name="generator"/ |
content="https://shop.polishfoodies.com/wp-content/uploads/2021/11/cropped-Sygnet-Polish-Foodies-v3-270x270.png" name="msapplication-TileImage" |
Your Cart Call us: +48 17 283 1534 Worldwide shipping Help MENU Search for: Search My Account Customer Help Checkout $ 0.00 0 Polish Cookbooks Poland Clothes Women Matching Clothes Polish Accessories BlogContact Us Browse My Account Customer Help Want to chat? Call us toll free +1 789 2000 Social Facebook Twitter Instagram $ 0.00 0 Be proud of your Polish heritage! New Products! Don’t miss out on some very special items at extraordinary prices. For a limited time! Pick up a bargain → Why Polish Foodies Shop? We believe in connecting all Poles around the World. With a clever offering, superb support and a secure checkout you’re in good hands. Smart ideas With dozens of intelligent concepts, you’ll find what you’re looking for in our store, and it will be unique and personalized to match. Outstanding support Our customer support is second to none – users rave about how we don’t rest until every issue is solved to their satisfaction. Secure checkout With 128-bit SSL security with advanced encryption you are guaranteed that your purchases are safe. Our latest items Polish Breads Cookbook $ 24.00 – $ 39.99 inc. VAT Select options Polish Soups Cookbook $ 24.00 – $ 39.99 inc. VAT Select options Polish Cakes & Desserts Cookbook $ 24.00 – $ 39.99 inc. VAT Select options Organic cotton apron Folk Heart $ 44.63 – $ 52.50 inc. VAT Select options Scrunchie Folk $ 13.26 inc. VAT Add to cart Headband Folk $ 11.22 inc. VAT Add to cart Women’s short sleeve t-shirt Folk Heart $ 30.18 – $ 32.73 inc. VAT Select options Skater Skirt Folk $ 56.10 – $ 59.08 inc. VAT Select options Our most popular products Pierogi-Saur Unisex Hoodie $ 45.48 – $ 58.65 inc. VAT Select options Keep Calm And Let The Polish Girl Handle It – Tank Top $ 35.28 – $ 38.25 inc. VAT Select options Polish Food Is My Therapy T-shirt $ 32.30 – $ 35.70 inc. VAT Select options Polish Fat Thursday Cookbook $ 9.00 – $ 24.00 inc. VAT Select options Worldwide shipping USA, Canada, UK, Australia and other countries Easy 30 days returns 30 days money back guarantee International Warranty Offered in the country of usage 100% Secure Checkout PayPal / MasterCard / Visa Help My Account Customer Help Contact Us Terms and Conditions Follow Polish Foodies Facebook Group Facebook Instagram Pinterest Youtube Sign Up Sign up to our newsletter and receive 10% off your first order Polish Foodies Clothes! Sign Up © Polish Foodies...
Domain Name: POLISHFOODIES.COM Registry Domain ID: 2459447874_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.cloudflare.com Registrar URL: http://www.cloudflare.com Updated Date: 2023-10-26T19:57:49Z Creation Date: 2019-11-25T11:40:19Z Registry Expiry Date: 2024-11-25T11:40:19Z Registrar: CloudFlare, Inc. Registrar IANA ID: 1910 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: KARL.NS.CLOUDFLARE.COM Name Server: LIV.NS.CLOUDFLARE.COM DNSSEC: signedDelegation DNSSEC DS Data: 2371 13 2 ADB392CEA432DC050FC4B58D02E55E1BBC6AE8887D5BBEB6A5B8D92808D5242A >>> Last update of whois database: 2024-05-17T14:18:59Z <<<